PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K01117.1.p
Common NameMIMGU_mgv1a019002mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 193aa    MW: 21255 Da    PI: 5.277
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K01117.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB130.75e-41187894
             NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                      +Pian++rim+ +lPa+aki++dake++qec+sefisf+t ea+ +c+re rkti+++d+l a+a+lGf +y+epl+++l+k+r  +
  Migut.K01117.1.p  1 MPIANIIRIMRSILPAHAKIADDAKEVIQECISEFISFITIEANGRCHREYRKTITPEDVLAAMASLGFTNYLEPLTIFLNKHRAQK 87
                      8**********************************************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008084.6E-22164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.104.9E-41195IPR009072Histone-fold
SuperFamilySSF471135.43E-33199IPR009072Histone-fold
PRINTSPR006154.1E-142846No hitNo description
PRINTSPR006154.1E-144765No hitNo description
PRINTSPR006154.1E-146684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MPIANIIRIM RSILPAHAKI ADDAKEVIQE CISEFISFIT IEANGRCHRE YRKTITPEDV  60
LAAMASLGFT NYLEPLTIFL NKHRAQKDSD RSSMNPLPQF VRRSGAADGG SGFVQYQEPQ  120
GSHMVRHLPR TPPPPPVAPT TGYYVPLPPV AATTMEEEEE FGELTTTVND YIFGNHGGGE  180
GSSGEFDLFQ KF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-32184992NF-YB
4awl_B1e-321841093NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-321841093NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838119.11e-141PREDICTED: uncharacterized protein LOC105958650
SwissprotQ9SFD82e-41NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A022R9A21e-142A0A022R9A2_ERYGU; Uncharacterized protein (Fragment)
STRINGscaffold_102469.11e-40(Arabidopsis lyrata)
STRINGscaffold_102467.11e-40(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.19e-43NF-YB family protein